SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000306397 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000306397
Domain Number 1 Region: 135-272
Classification Level Classification E-value
Superfamily ISP domain 7.07e-39
Family Rieske iron-sulfur protein (ISP) 0.000000935
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 2.83e-24
Family ISP transmembrane anchor 0.000024
Further Details:      
 
Domain Number 3 Region: 1-57
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 6.87e-21
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000306397
Sequence length 274
Comment UQCRFSL1 (Homo_sapiens) ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide-like 1
Sequence
MLSVAARSGPFAPVLSATSRGVVGALRPLVQASVPATSEPLVLDVKRPFLCRESLSGQAV
GRPLVASVGLNVPASVRYSHTDVRVPDFSDYRRTEVLDSTKSSKESSEARKAFSYLVTAT
TTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLADIPEGKSMAFKWRGKPLFVRHRT
QKEIEQEAAVEVSQLRDPQHDLERVKKPEWVVLIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRKGPAPLNLEVPTYHFPSDDLLIVG
Download sequence
Identical sequences G5BL47
HGL_H00000306397 XP_004858828.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]