SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000311184 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000311184
Domain Number 1 Region: 428-563
Classification Level Classification E-value
Superfamily TIMP-like 3.61e-30
Family Netrin-like domain (NTR/C345C module) 0.034
Further Details:      
 
Domain Number 2 Region: 205-300
Classification Level Classification E-value
Superfamily Immunoglobulin 3.22e-21
Family I set domains 0.028
Further Details:      
 
Domain Number 3 Region: 381-433
Classification Level Classification E-value
Superfamily BPTI-like 1.33e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 4 Region: 320-376
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000017
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.016
Further Details:      
 
Domain Number 5 Region: 119-169
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000984
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 33-84
Classification Level Classification E-value
Superfamily Elafin-like 0.000000144
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000311184
Sequence length 572
Comment WFIKKN2 (Homo_sapiens) WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2
Sequence
MWALGIHPSWSHRGLLLLLLLLGVALTGLALPPIRYSHAGICPNDMNPNLWVDAQSTCKR
ECEADQECESYEKCCPNVCGTRSCVAARYMDVRGKKGPVGMPKEATCDHFMCLQQGSECD
IWDGQPVCKCKERCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFTWPNT
SPPPPETTVHPTTASPETPGQDLAAPALIHHPAHQSVTVGETVSFLCDVAGRPRPEITWE
KQLEDRENVIMRPNHVRGNVVVTNIAQLVIYNARPQDAGIYTCTARNAAGVLRADFPLSV
VRGGLAETPSQSSPNGTAFPAAECLKPPDSEDCGEEQTRWHFDAQANNCLTFTFGHCHRN
LNHFETYEACVLACMRGPLAVCSLPALQGPCKAYSPRWAYNSQTAQCQSFVYGGCEGNGN
NFETREACEESCPFPRGNQHCPACKPRQKLVTSFCRSDFVILGRVSELTEEADTGRALVT
VDEVLKDEKMGLKFLGREPLEVTMLQVDWACPCPNVTVGEAPLIIMGQVEGGMAMLRPDS
FVGVSSARRVRKLREVLHKKTCDVLKEFPGLH
Download sequence
Identical sequences HGL_H00000311184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]