SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000312435 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000312435
Domain Number 1 Region: 220-342
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 3.66e-59
Family Dystroglycan, domain 2 0.000000371
Further Details:      
 
Domain Number 2 Region: 535-636
Classification Level Classification E-value
Superfamily Cadherin-like 9.89e-19
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 132-198
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000126
Family Dystroglycan, N-terminal domain 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000312435
Sequence length 933
Comment DAG1 (Homo_sapiens) dystroglycan 1 (dystrophin-associated glycoprotein 1)
Sequence
MDRRNIEGQCTIWKPWGLLKSASALLFQALGALGWSRCAESEDLALGPHHLFPSSVRLST
WQAQAWKRMSVGCSLLFPLWGRTLLLLLSVAKAQARWPSEPSEAVRDWENQLEASMHSVL
SDLHEAVPTVVGIVSAAGKEALPSWLHWDPQSHTLEGLPLDTDKGVHYISVSAARLGANG
SHVPQTSSVFSIEVYPEDHSEPQSIRAASPDPDEIVSSVCAADEPVTVLTVILDADLTKM
TPKQRIDLLHRMQSFSEVEIHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKL
GCFLNQNNVPDIHGVEVPAREGAMSAQLGYPVVGWHIANKKPPLPKRIRRQIHATPTPVT
AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMVPPVRDPVPGKPTVTIRTRGAIIQTPTL
GPIQPTRVSEVGTTVPGQIHPTMTIPGYGEPTAVATPPTSTTKKPRVSTPKPATPSTDSS
TTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRIRTTTSGVPRGGEPNQRPELKNH
IDKVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKLREQQLIGEKSWVQFNSNSQLMY
GLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGDKAPARFKAIFTGDLASVVND
IHKKIALVKKLAFAFGDRNCSTITLQNITQGSIVVEWTNNTLPLEPCPKEQITTLSKRIG
EDNGKPRPAFSNALEPDFKAMSIAVTGSGSCRHLQFIPVAPPKRVPSEVPPTEVPDRDPE
KSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLTLEDQATFIKKGVPIIFAD
ELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSLPETTPLNQDTMGEYTPLQDEDPNAPP
YQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences G5BZW6
HGL_H00000312435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]