SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000312550 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000312550
Domain Number 1 Region: 531-638
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-19
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 2 Region: 168-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-16
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 3 Region: 343-459
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000131
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 4 Region: 289-351
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000038
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 643-701
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000144
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 703-764
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 771-837
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000301
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 8 Region: 464-529
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000511
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000312550
Sequence length 910
Comment SEZ6L2 (Homo_sapiens) seizure related 6 homolog (mouse)-like 2
Sequence
MGTPKAQHPPPPQLLFLILLSCPWIQGLPLKEEEALPEPGSESPTVASEALAELLHGALL
RKGPEMGYLPGAEPDPTLATPPAGQTLAAPSLPRATEPGTGPLTTAVTPQGARGSGPTAP
ELLTPPPGSTATPPPGHASPVPPLGPEGAEEETTTTIITTTTVTTTATSPVLCNNNISEG
EGFVESPDLSSPSGRTSGLLDCTYSIHVYPGYGIEIQVQTLNLSQEEELLVLAGGGSPGL
APRLLANSSMLGEGQVLRSPTNRLLLHFQSPRAPRGGGFRIHYQAYLLSCGFPPRPAHGD
VRVTDLHPGGTTAFHCDSGYQLQGEETLICLNGTRPAWSSEPPSCVASCGGTIHNATLGR
IVSPEPGGAVGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDS
DMDDVPERGLLSDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPE
YRPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLS
PDWPQSYSPGQDCVWGLHVQEEKRILLQVEILNVREGDVLTLFDGDGPSARVLAQLRGPQ
PRRRLLSSGPDLTLQFQAPPGPPSPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHG
DLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEITNGHRTASD
AGFPVGSHVQYRCLPGYSLEGAAVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENG
YQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVTQTTDPSRQL
EGGNLALAILLPLGLVIVLGSGVYVYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYEA
GDTREYEVSI
Download sequence
Identical sequences G5BYN0
HGL_H00000312550 XP_004856184.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]