SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000316203 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000316203
Domain Number 1 Region: 229-424
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.79e-59
Family CRAL/TRIO domain 0.00000000317
Further Details:      
 
Domain Number 2 Region: 428-548
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 7.85e-38
Family Supernatant protein factor (SPF), C-terminal domain 0.000000318
Further Details:      
 
Domain Number 3 Region: 78-141
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000183
Family CRAL/TRIO domain 0.0000313
Further Details:      
 
Domain Number 4 Region: 196-225
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000327
Family CRAL/TRIO N-terminal domain 0.00061
Further Details:      
 
Domain Number 5 Region: 48-77
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000497
Family CRAL/TRIO N-terminal domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000316203
Sequence length 555
Comment SEC14L2 (Homo_sapiens) SEC14-like 2 (S. cerevisiae)
Sequence
MSRTCCLPCRIQMTIFSYAGSEGLEPGFELPRSREAGALERPNLAGTARSFDLQKSEAML
RKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLEGCPVWYDIIGPLDAKGLLFSAT
KQDLLRTKMRDCELLLQECARQTTKETGLEFTTVKSGNELSCSRRVMMKGPVTFLAQVLG
LSADLDANQVHGSYTARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGM
CGYDLEGCPVWYDIIGPLDAKGLLFSATKQDLLRTKMRDCELLLQECARQTTKLGKKIET
ITMIYDCEGLGLKHLWKPAIEAYGEFLCMFEENYPETMKRLFVVKAPKLFPVAYNLIKPF
LSEDTRKKIMVLGANWKEVLLKHVSPDQLPVEYGGTMTDPDGNPKCKSKINYGGDIPKKY
YVRDQVKQQYEHSVQIARGSSHQVEYEILFPGCVLRWQFMSEGADVGFGIFLKTKMGERQ
RAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVSFTVEVLLPDK
ASEEKMNQLGAETSK
Download sequence
Identical sequences G5APU9
HGL_H00000316203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]