SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000316664 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000316664
Domain Number 1 Region: 277-379
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000187
Family V set domains (antibody variable domain-like) 0.018
Further Details:      
 
Domain Number 2 Region: 24-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000271
Family I set domains 0.062
Further Details:      
 
Domain Number 3 Region: 419-523
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000529
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 
Weak hits

Sequence:  HGL_H00000316664
Domain Number - Region: 139-255
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00039
Family V set domains (antibody variable domain-like) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000316664
Sequence length 582
Comment IGSF8 (Homo_sapiens) immunoglobulin superfamily, member 8
Sequence
MGAPGPAPLSLLLMLGIGCCAREVLVPKGPLYRVAGTTVFIPCNVSGYEGPAQQDFEWFL
YRPEAPEAALGIISTRDARFAYAVFAPRVQDAGVYECYTPSTDARYLGSYSGKVELRVLP
DTLQVSAAPPGPRGRQAPTSPPRLTVYEGQELALGCLARTSTQEHTHVAVSFGRVVPEVP
VGRATLQEVVGLRSDLAVEAGGPYAERLTAGELRLGKEGADRYRMVVGGTQAGDAGTYHC
TAAEWIQDPDGSWAQIAEKRAVLAQVDVQTLSSQLAVTVGPGERRIGPGEPLELLCNVSG
ALPPQGRHAAYSVGWEMAPAGAPGPGRLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYR
LRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVREEGVVLEAVAWLAGG
TVYRGETASLLCNISVRGGPPGLRLAASWWVERQEDEQSSAPAQLVGSMNQDGVAELGVR
PGGGPVSVELVGPRSHRLRLHSLGPEDEGVYHCAPSAWVQHADYSWYQAGSARSGPVTVY
PYMHALDTLFLPLLVGTGVALVTGAIVLGTITCCFMKRLRKR
Download sequence
Identical sequences HGL_H00000316664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]