SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000323194 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000323194
Domain Number 1 Region: 956-1083,1279-1468
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-52
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 3-111
Classification Level Classification E-value
Superfamily Sema domain 2.09e-24
Family Sema domain 0.014
Further Details:      
 
Domain Number 3 Region: 556-643
Classification Level Classification E-value
Superfamily E set domains 3.56e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Domain Number 4 Region: 462-556
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000271
Family Other IPT/TIG domains 0.006
Further Details:      
 
Domain Number 5 Region: 641-745
Classification Level Classification E-value
Superfamily E set domains 0.000000000000013
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 
Domain Number 6 Region: 114-166
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000602
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 7 Region: 742-831
Classification Level Classification E-value
Superfamily E set domains 0.000000826
Family E-set domains of sugar-utilizing enzymes 0.078
Further Details:      
 
Domain Number 8 Region: 413-446
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000798
Family Plexin repeat 0.0029
Further Details:      
 
Weak hits

Sequence:  HGL_H00000323194
Domain Number - Region: 258-290
Classification Level Classification E-value
Superfamily Plexin repeat 0.0222
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000323194
Sequence length 1498
Comment PLXNA4 (Homo_sapiens) plexin A4
Sequence
LLTIDDNFCGLDMNAPLGVSEMVRGIPVFTEDRDRMTSIIAYVYKNHSLAFVGTKSGKLK
KIRVDGPRGNALQYETVQVVDPGPVLRDMAFSKDHEQLYIMSERQLTRVPVESCSQYRSC
SECLGSGDPHCGWCVLHNTCTRKERCERSREPRRFASEMKQCVRLTVHPNNISVSQYNVL
LVLETYNVPELSAGVNCTFEDLSEMDGLVVGNQIHCYSPAAKEVPRIITENGDHHVVQLQ
LKSKETGMTFASTSFVFYNCSVHNSCLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVK
LPEDCPQLLRVDKILVPVEVIKPITLKAKNLPQPQSGQRGYECILNIQGSEQRVPALRFN
SSSVQCQNTSYSYEGMEINNLPVELTVVWNGHFNIDNPAQNKVHLYKCGAMRESCGLCLK
ADPDFECGWCQNPGQCTLRQHCPAHESRWLELSGANSKCTNPRITEIIPVTGPREGGTKV
TIRGENLGLEFRDIASHVKVAGVECSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAL
CRPEFMARSSQLYYFMTLTLLDLKPSRGPMSGGTQVTITGTNLNAGSNVVVMFGKQPCLF
HRRSPSFIVCNTTSSDEVLEMKVTVQVDRARIRQDLVFQYVEDPTIVRIEPEWSIVSGNT
PIAVWGTHLDLIQNPQIRAKHGGKEHINICEVLNATEMTCQAPALALDPDYQSDLTERPE
EFGFILDNVQSLLILNKTNFTYYPNPVFEAFGPSGILELKPGTPIILKGKNLIPPVAGAN
VKLNYTVLVGEKPCTVTVSDVQLLCESPTLIGRHKVMARVGGMEYSPGMVYIAPDSPLSL
PAIISIAVAGGLLIIFIVAVLIAYKRKSRESDLTLKRLQMQMDNLESRVALECKEAFAEL
QTDIHELTSDLDGAGIPFLDYRTYTMRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFA
QLINNKVFLLSFIRTLESQRSFSMRDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKN
LESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDA
ITGEARYSLSEDKLIRQQIEYKTLVLSCVSPDNANSPEVPVKILNCDTITQVKEKILDAI
FKNVPCSHRPKAADMDLEWRQGSGARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVA
LVSKQVTAYNAVNNSTVSRTSASKYENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVK
NHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYM
FDFLDEQADKHGIHDPHVRHTWKSNCLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQ
TFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYSDIGKMPAISDQDMNAYLAEQ
SRMHMNEFNTMSALSEIFSYVGKYSEEILGPLDHDDQCGKQKLAYKLEQVITLMSLDS
Download sequence
Identical sequences G5C7Z8
HGL_H00000323194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]