SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000324450 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000324450
Domain Number 1 Region: 45-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-36
Family SCAN domain 0.0000647
Further Details:      
 
Domain Number 2 Region: 969-1025
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.48e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 720-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 912-969
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 762-814
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.48e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 874-926
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.67e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Weak hits

Sequence:  HGL_H00000324450
Domain Number - Region: 804-844
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00345
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000324450
Sequence length 1044
Comment ZSCAN20 (Homo_sapiens) zinc finger and SCAN domain containing 20
Sequence
MAVALVSEAQASPPSEPDDLLIVKLEEDSWGSEPKTLKDCDPVPGPEASRQRFRQFQYRD
AAGPHEAFSQLWALCCHWLRPEIRLKEQILELLVLEQFLIILPQEVQSWVQARHPESGEE
AVALVEDWHREAQAAQQRELEWCAEETKPLKAAQESQRFQLQPADHRPEGQSQKQWVKNL
CSDLPKHLNAKMASHLLKESAVLTPRVPTLPKMGSVGDWEVTAESQEALGPGKHDEKEFC
KDPAGDDCGNSMCLGVSVLKPSVTSQLEQGSEFWDVNLIDSVKRSTADYNLDNEPTKPAQ
ALALKDSRAWEEQYQWDVEDMKVSGVHWGYEETKTFLAILSESPFSEKLRTCHQNRQVYR
AISERLRARGFLRTLEQCRYRVKNLLRNYRKAKSSHPPGTCPFYEELEALVRARTAIRAT
SGSGEAVTLPRLGDSDAEMDEQEEGGWEPEETTEDYSNAGLATDESAQGARIAGGPALLQ
SRIAGVHWGYEETKAFLAILSESPFSEKLRTCHQNSQVYRAIAERLCALGFLRTLEQCRY
RFKNLLRSYRKAKSSHPPGTCPFYEELDSLMRARTSVRAMETVREATGLPRSGQNSTETD
DQEPWSEMADEDAIKPPTPCPKTPDTGFELRHKDEEQVSEQDIFEDLPGALPKYTSEAVY
SLHDWGEDSENENEGEGIWGNPPQEQWEECSSEEDLEKLIDHQGLYLAEKPYKCDICVKS
FNRSSHFIAHQRIHTGEKPYTCLECGKSFSDRSNLNTHQRIHTGEKPYRCLECGKRFSDH
SNLITHQRIHTGEKPYKCGECWKSFNQSSNLLKHQRVHLGGNPDQCSETGESIGHSPSVS
AHWMDFTEGTAEPSHSVGMNVSFPISHSTNAGEKLYQCSECRRCFSKSSALISHQRIHTG
EKPYECADCGKSFSKSSTLANHQRTHTGEKPYKCVDCGKCFSERSKLITHQRVHTGEKPY
KCPECGKFFRDRSNLITHQRIHTGEKPYKCRECGKCFNQSSSLIIHQRIHTGEKPYKCTE
CGKDFNNSSHFSAHRRTHTVGKAS
Download sequence
Identical sequences G5B5L2
XP_004850963.1.39548 HGL_H00000324450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]