SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000330031 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000330031
Domain Number 1 Region: 23-243
Classification Level Classification E-value
Superfamily PAZ domain 1.08e-52
Family PAZ domain 0.003
Further Details:      
 
Domain Number 2 Region: 223-479
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.47e-42
Family PIWI domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000330031
Sequence length 534
Comment PIWIL3 (Homo_sapiens) piwi-like 3 (Drosophila)
Sequence
MRVDSQNHGFLESCSVNKSLVKQDKYRSRTLKLMNFKQIGRNYYDENSKENFCDNRLEAW
RGYVTSVLPYEHSLTLCSDICHKLLRLETAYDIIMRRCEKSLQDKYIREEVSKELVGLIV
FTRYNNKTYRVDAINWDQSPRDTFKKSDGSEITFVEYYMQQYNQIITDLDQPLLVSQGRW
RKGQKNTPHEPVLLIPQLCYPTGLSDELRQKSKDMSKLTKFMQLYPWERKNELEAFINKI
RVNRTAQNELQRWSLRFDTNCLPISGRILRDVKIFQRDVSFGIGPQPADWMRESRSTPLL
TVKSLSHWVLLHPREHGNNAQSLLRSLRKVTPTMGITVGQANMYEVNEDPSSYISTLRKC
VTSHTNMVVCILPDSEKYRYDEIKKFLCIHCPVPSQCVVAETLMSGNTLLTITTKIAQQM
NCKMGGALWKVETAALDSWFRNVQQQPDSVVVYRDGVGDGQLQALLDHEIPQLVSHLRKH
HGFPSQLAQFLRDDMFIHGVGVLSEEAGDRLLEEVLVHLVHIHCDTHSTPTVPA
Download sequence
Identical sequences G5AWY2
HGL_H00000330031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]