SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000335153-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000335153-1
Domain Number 1 Region: 6-153
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.45e-36
Family Heat shock protein 90, HSP90, N-terminal domain 0.000000929
Further Details:      
 
Weak hits

Sequence:  HGL_H00000335153-1
Domain Number - Region: 217-244
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00349
Family Hsp90 middle domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000335153-1
Sequence length 244
Comment HSP90AA2 (Homo_sapiens) heat shock protein 90kDa alpha (cytosolic), class A member 2
Sequence
MEEEEVETFTFQAEIAQLMSLIINTFYLNKEIFLGELISNLSDALDKIRYESLTDPSKLD
SGKEMHINLIPDKQVHTHTIVDTGIRMTKAEMINNLGTIAKTDTGEPMGQGTKVILHLKE
DQTEYLGERRIKEIVKKHSQFIGYPITLFVEKEQGKVSDDEAEEKEDKEEDKEKEEKESD
DKPEIEDVDSDEEEEKKDGDKKKKIKEKYIDQEELDKTKSIWTRNPDNISNKEYGEFYKS
LTSD
Download sequence
Identical sequences G5BF95
HGL_H00000335153-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]