SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341243 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341243
Domain Number 1 Region: 205-365
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 1.07e-61
Family DNA-binding protein LAG-1 (CSL) 0.00000769
Further Details:      
 
Domain Number 2 Region: 54-207
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.57e-56
Family DNA-binding protein LAG-1 (CSL) 0.0000391
Further Details:      
 
Domain Number 3 Region: 366-478
Classification Level Classification E-value
Superfamily E set domains 3.78e-32
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341243
Sequence length 518
Comment RBPJL (Homo_sapiens) recombination signal binding protein for immunoglobulin kappa J region-like
Sequence
MDPGGAAGSSEPPGPLTHLSLQDGSEAARLQSGADGRSLPGSWTSSSPERATELREGVRS
CLQQQCEQTVRILHAKVAQKSYGNEKRFFCPPPCVYLTGPGWRVKPAQGQAHQAGDIGPT
VCGYMGLDGASGSATETQKLHFEEQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGR
ELGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFV
ASARQWAAFTLRLADEHCSQGDFPPREGYIRYGSLVQLVCTVTGITLPPMIIRKVAKQCA
LLHVDEPISQLHKCAFQFPGGPPGGGGTYLCLATEKVEQFQASPCPKEENRALLNDSSCW
TIIGTESVEFAFSTRLACTREPVTPVPLICTLELSGGGHVATLELHGENFHAGLKVWFGD
VEAETMYRSPRSLVCVVPDVMAFGSDWRWLRTPITVPVSLVRADRLFYPSAFSLTYTPEY
SAGPGQPSAPKPAADADALLESIHHEFTRTNFHLFVQT
Download sequence
Identical sequences G5BB20
HGL_H00000341243 XP_004858227.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]