SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341885-5 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341885-5
Domain Number 1 Region: 159-239
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.54e-26
Family Translational machinery components 0.0035
Further Details:      
 
Domain Number 2 Region: 77-148
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.99e-22
Family Ribosomal S5 protein, N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341885-5
Sequence length 256
Comment RPS2 (Homo_sapiens) ribosomal protein S2
Sequence
MADDAGAAGGPGGPGGPGTGGRGGFRGGFGSGLRGRTRREWIPVTKLGRLVKDMKIKSLE
EIYLFSLPIKESEIIDFFLGTSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGL
GVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAP
RGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKET
VFTKSPYQVLQLWLAL
Download sequence
Identical sequences G5BY57
HGL_H00000341885-5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]