SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000345206-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000345206-1
Domain Number 1 Region: 176-333
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 2.35e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 30-178
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.98e-66
Family DNA-binding protein LAG-1 (CSL) 0.0000107
Further Details:      
 
Domain Number 3 Region: 334-446
Classification Level Classification E-value
Superfamily E set domains 1.21e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000345206-1
Sequence length 500
Comment RBPJ (Homo_sapiens) recombination signal binding protein for immunoglobulin kappa J region
Sequence
MDHREGSPAEEQPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRASSSQVPTNESNTNSEGS
YTNASTNSTSVTSSTATVVS
Download sequence
Identical sequences G5B015
HGL_H00000345206-1 XP_012928586.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]