SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000345206-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000345206-2
Domain Number 1 Region: 148-305
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 1.44e-61
Family DNA-binding protein LAG-1 (CSL) 0.00000145
Further Details:      
 
Domain Number 2 Region: 306-418
Classification Level Classification E-value
Superfamily E set domains 1.9e-37
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 41-150
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.47e-29
Family DNA-binding protein LAG-1 (CSL) 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000345206-2
Sequence length 472
Comment RBPJ (Homo_sapiens) recombination signal binding protein for immunoglobulin kappa J region
Sequence
MDTSSSKARGLWPFTSAAGGGIPETTGAEQALVRPRGRGAPPFVFTRRGSMFYEKKEQME
RDGCSEQESQPCAFIEMGNSDQEMPQLNLEGKNYRTARTLYISDSDKRKHFMLSLKMFYG
NSDDIGVFLSKRIKVIPKPSKKKQSLKNADLCIASGTKGALFNQLRSQTVSTRYLPVEGG
NFHASSQQWEAFYIHLLDDDESEEEEFTVQDGYLHYGQTVKLVCSVTGMALPKLIIRKVD
KQTALLEADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCLKEPNKEMINDGASW
TIISTDKAEYTFYKGMGPVLAPVTPVPVVESLQLNGSGDVAMLELTGQNFTPNLQVWFGD
VEADTMYRCEESMPCVIPDISAFQEGWRWVQQPVQVPVTLVCNDGTTYSTTLTFTYTPDP
GPRPHCSATGAILRASSSQVPTNESNTNSEGSYTNARTNSTSVTSSTATVVS
Download sequence
Identical sequences G5B4E5
HGL_H00000345206-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]