SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000352819 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000352819
Domain Number 1 Region: 344-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000231
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 381-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000993
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 108-138
Classification Level Classification E-value
Superfamily SET domain 0.00000445
Family Histone lysine methyltransferases 0.064
Further Details:      
 
Domain Number 4 Region: 150-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000046
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000352819
Sequence length 478
Comment PRDM13 (Homo_sapiens) PR domain containing 13
Sequence
MQGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVLAIPTSAPRQR
PLLVLQVRMVRGELVDESGGSPLEWIGLIRAARSPQEQTLEAYADLPGGQIFYRALRDVQ
PGEELTVWYSNSLAQWFDIPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVL
SGGGGRAFLHHEHAARQGAAQAPADGFGLSPKPAAPDFAAPAQTGTLRPQTQVLQPPQAC
GARESIKREASSAPSASSPTPGKWGPPKKVKEQQDLVLDVSGPARAHSHFLGIMGGSQAG
GGGLAFYPGVRSAFKPAGLARVAAAAHGDPYREEGSGNKPKTGHLCLYCGKLYSRKYGLK
IHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHV
KSRHPGQSLLAKADDGPGTEPAYPLEPRDPKSEDSDVDVCFTDDQSDVEAEGGGDRDL
Download sequence
Identical sequences G5ARX5
HGL_H00000352819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]