SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355517 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355517
Domain Number 1 Region: 10-180,283-387
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-48
Family FAD-linked reductases, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355517
Sequence length 486
Comment KMO (Homo_sapiens) kynurenine 3-monooxygenase (kynurenine 3-hydroxylase)
Sequence
MDSSDNQRRKVAVIGGGLVGALNACFLAKRNVQVDLYEAREDIRMAKTARGRSINLALSY
RGRQALKAIDLEDQIVSQGIPMRARMIHSLSGKKSALPYGTKDQYILSISRENLNKDLLN
AVEKHPNVQVHFGHRLLKCNPEEGTITVLGADKVPKDVTYDLIVGSDGAYSTVRNHLMKK
PRFDYSQHYIPHGYLELTIPPKNGDFAMEPNYLHIWPRNTFMMIGLPNLDKSFTCTLFMP
FDEFEKLLTSKDVLDFFQKYFPDFISLTEKQALVQDFFLLPPQAMISVKCSSFHFKSHCV
LMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRVRIPDAHAISDLS
IYNYMEMRAHVNFKWFIFQKTIERFLHAIMPSTFTPLYTMVTFSRIGYHEAVLRWHWQKK
VIKKGLFVFGSLVAIGTTYLLVHYMSPRPLDYLRPWKWSRLLPGYGAHFPANSMEPLEQT
PYFISQ
Download sequence
Identical sequences G5BL28
HGL_H00000355517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]