SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355890 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355890
Domain Number 1 Region: 197-509
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 8.04e-87
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000778
Further Details:      
 
Domain Number 2 Region: 1021-1288
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.99e-71
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000839
Further Details:      
 
Domain Number 3 Region: 504-707
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 1.31e-51
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.00058
Further Details:      
 
Domain Number 4 Region: 1291-1420
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.87e-29
Family Anticodon-binding domain of Class II aaRS 0.00014
Further Details:      
 
Domain Number 5 Region: 751-805
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 1.73e-16
Family a tRNA synthase domain 0.0000866
Further Details:      
 
Domain Number 6 Region: 51-161
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.76e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.026
Further Details:      
 
Domain Number 7 Region: 1424-1511
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 4.71e-16
Family C-terminal domain of ProRS 0.0072
Further Details:      
 
Domain Number 8 Region: 824-878
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000000000549
Family a tRNA synthase domain 0.00013
Further Details:      
 
Domain Number 9 Region: 903-954
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000000000746
Family a tRNA synthase domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355890
Sequence length 1511
Comment EPRS (Homo_sapiens) glutamyl-prolyl-tRNA synthetase
Sequence
MATLCLTVTGGAPPREALLAAEHVKEDVSISVEGGKENVLRVSENVAFTDVYSILRYLAR
VAATAGLYGANVMEHAEIDHWLEFSATKLASCASFASAVNELNHCLSLRTFLVGNSLTLA
DFCVWAALKGNAAWQEEATQSKGPVHVKRWFSFLEAQRVFQSVSAKWGVPASKTQAASEK
KQDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTN
PEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIKEGKAYVDDTPAEQMK
AEREQRVESRHRSNSVEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCK
IQPHPRTGSRYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWVIEALGIRKPYI
WEYSRLNLNNTVLSKRKLTWFVHEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGS
SRSVVNMEWDKIWAFNKKVIDPVAPRYVALLKKEVVPVLVPEVQEEMKEAARHPKNPEVG
LKPVWYSPRVLIEGADAETLTEGETVTFINWGNISITKIHRNADGKIVSLDGKLNLENKD
YKKTTKITWLAETAQALPVPTICVTYEHLITKPVLGKDEDFKQYINKNSKREELMLGDPC
LKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCILIYIPDGHTKEMPTSGSKEKTK
GEATKTEMSPSLKERPAPPVYKSWAPSEDFLVLYNRVATQGDTVRELKARKAAKEDIDAA
VKQLLALKAEYKEMTGQEYKPGSPPAAGAQEAASQSPAAALESRSLYDRVAAQGELVRKL
KAEKALKAKINQAVECLLSLKAEYKEKTGKEYVPGQPPAPSSKSSPAGDRESSGPEAPEA
QVLFARVAAQGEVVRKLKAEKASKDQVDPAVQVLLQLKAQYKALAGVEYKPVSATGADDR
DKKKKDKENKSEKQNKPQKAHDGHGKEPFNSQGSGPTPGGAGEGQGPRKQTRLGLEAKKE
ENLADWYSQVITKSEMIEYYDVSGCYILRPWAYSIWESIKAFFDAEIKKLGVENCYFPIF
VSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLP
IRLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATFEEAAEEVLQILELYTRVYEELL
AIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMCEIVFEDPKT
PGEKQFAYQCSWGLTTRTIGVMVMVHGDNTGLVLPPRVASVQVVVIPCGITNALSEGDRE
ALMVKCSDYCRRLLGADIRTRVDLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVA
VRRDTGEKLTIAESEAEAKLEALLEDIHASLFRRASEDLKTHMVVADTMEDFQKTLDAGK
VAQIPFCGEIDCEDWIKKTTTRDQDLEPGAPSMGAKSLCIPFRPLQELQPGARCVCGKNP
AKFYTLFGRSY
Download sequence
Identical sequences G5AQT1
HGL_H00000355890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]