SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000356000 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000356000
Domain Number 1 Region: 21-490
Classification Level Classification E-value
Superfamily Sema domain 2.75e-127
Family Sema domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 1336-1461,1657-1845
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-50
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 937-1026
Classification Level Classification E-value
Superfamily E set domains 4.33e-18
Family Other IPT/TIG domains 0.079
Further Details:      
 
Domain Number 4 Region: 1025-1128
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000204
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.064
Further Details:      
 
Domain Number 5 Region: 841-939
Classification Level Classification E-value
Superfamily E set domains 0.00000000000117
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 493-544
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000183
Family Plexin repeat 0.0014
Further Details:      
 
Domain Number 7 Region: 1125-1205
Classification Level Classification E-value
Superfamily E set domains 0.000000224
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 8 Region: 789-823
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000275
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000356000
Sequence length 1876
Comment PLXNA2 (Homo_sapiens) plexin A2
Sequence
VLLAGLWVLLVPGAAGMPQFSTFHSENRDWTFNHLTVHRGTGAVYVGAINRVYKLTGNLT
VQVAHKTGPEEDNRSCYPPLIVQPCGEVLTLTNNVNKLLLIDYPENRLLACGSLYQGVCK
LLRLDDLFTLVEPSHKKEHYLSSVNKTGTMYGVIVRSEGRDGKLFIGTAVDGKQDYFPTL
SSRQLPRDPESAAMLDYELHSDFVSSLIKIPSDTLALVSQFDIFYIYGFASGGFVYFLTV
QPETPEGVSVSSAGDLFYTSRIVRLCKDDPKFHSYVSLPFGCTRAGVEYRLLQAAYLAKP
GDALAQAFNISSQDDVLFAIFSKGQKQYHHPPDDSALCAFPIRTVNLQIKERLQSCYQGE
GNLELNWLLGKDVQCTKAPVPIDDSFCGLDINQPLGGSTPVEGLTLYTTSRDRMTSVAFY
VYNGCSVVFVGTKSGKLRKIRADGPPHGGVQYEMVSVLKDGSPILRDMAFSIDQRYLYVM
SERQVTRVPVESCEQYTTCGECLSSGDPHCGWCALHNKCSRRDKCHRAWEPNRFAASISQ
CMSLAVQPSSISVSEHSQKLNLVVSDAPDLSAGVTCAFGNLTEVEGRVSGSTIICTSPGP
KDVPSVPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYR
NVCTHDPTTCSFQEGRINISEDCPQLVPTEEILIPVGEVKPITLKARNLPQPQSGQRGYE
CVLSIQGAIHRVPALRFNSSSVQCQNSSYQYDGMDISNLAVDFAVVWNGNFIIDNPQNLK
VHLYKCAAQRESCGLCLKADRKFECGWCSGERKCTLQQHCSSPASPWLDWSSHNVNHNVK
CSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAGVPCAPLPGEYIIAEQI
VCEMGHALVGTTSGPVRLCIGECKPEFMTKSHQQYTFVNPSVLSLNPIRGPESGGTMVTI
TGHYLGSGSSVAVSLGNQTCEFYGRSMNEIVCVSPPSSNGLGPVPVSVSVDRARVDNSLQ
FEYIDDPRVQRVEPEWSITSGHTPLTVTGFNLDVIQEPRIRVKFNGKESVNVCKVVNATT
LTCLAPSLTTDYRPGLDTVERPEEFGFVFNNVQSLLIYNDTKFTYYPNPTFELLSPTGVL
DQKPGSPIILKGKNLCPPASGGAKLNYTVLIGETPCAVTVSETQLLCEPPTLTGQHKVTV
LVGGTVFSPGSVSVVSDSLLTLPAIVSIAAGGSLLLVIVIMVLIAYKRKSRENDLTLKRL
QMQMDNLESRVALECKEAFAELQTDINELTSDLDRSGIPYLDYRTYAMRVLFPGIEDHPV
LRELEVQGNGQQHVEKALKLFAQLINNKVFIRTLELQRSFSMRDRGNVASLIMTGLQGRL
EYATDVLKQLLSDLIEKNLENKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKECAGEPL
FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVK
ALNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDW
KRLNTLLHYQVSDRSVVALVPKQTSSYNMPASASISRTSISRYDSSFRYTGSPDSLRSRA
PMITPDLESGVKIWHLVKNHDHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFET
LFSTVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKSNCLPLRFWVNVIKNPQFV
FDIHKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYADI
AKLPAISDQDMNAYLAEQSRLHAAEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQR
LAYKVEQLISAMSIES
Download sequence
Identical sequences G5BP07
HGL_H00000356000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]