SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000359371 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000359371
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000155
Family HLH, helix-loop-helix DNA-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000359371
Sequence length 98
Comment BHLHE23 (Homo_sapiens) basic helix-loop-helix family, member e23
Sequence
MGSPSVRKLSKIATLLLAKNYILMQAQALDEMRRLVAYLNQGQGLAAPVAPAPLTPFGPT
AASYTIFIHCLPYPQQPAAGLRLTPGTRWLAKQKQSAE
Download sequence
Identical sequences G5C8D9
HGL_H00000359371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]