SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361735 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361735
Domain Number 1 Region: 74-137
Classification Level Classification E-value
Superfamily BPTI-like 8.66e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0053
Further Details:      
 
Domain Number 2 Region: 33-81
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000131
Family Elafin-like 0.0041
Further Details:      
 
Domain Number 3 Region: 140-185
Classification Level Classification E-value
Superfamily Elafin-like 0.000000011
Family Elafin-like 0.002
Further Details:      
 
Domain Number 4 Region: 185-230
Classification Level Classification E-value
Superfamily Elafin-like 0.000000458
Family Elafin-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361735
Sequence length 231
Comment WFDC8 (Homo_sapiens) WAP four-disulfide core domain 8
Sequence
HLPLHCPTFSWRNITLLMLLSLSLEQTSASYAKKIKKKPGVCPKERLIHSTKLLDLCKMD
SDCQDSLKCCLFGCRKRCMDPYEEPCMLPLKTGNCQENLNRWYFDFKQYQCKPFIYSGCQ
GNVNNFLDRYECQDACMLIVKEGQCPLFPYDARTECPASCKSDIDCLEKEKCCESSCGFV
CAKAWTVKAGFCPAKRVSCDYVNKPLCLNDADCPLKEKCCPFCGLKCIHPR
Download sequence
Identical sequences G5B7N5
HGL_H00000361735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]