SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000370034 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000370034
Domain Number 1 Region: 457-777
Classification Level Classification E-value
Superfamily L domain-like 1.41e-46
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 21-418
Classification Level Classification E-value
Superfamily L domain-like 3.23e-35
Family Ngr ectodomain-like 0.00084
Further Details:      
 
Domain Number 3 Region: 866-1020
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.22e-34
Family Toll/Interleukin receptor TIR domain 0.0000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000370034
Sequence length 1032
Comment TLR7 (Homo_sapiens) toll-like receptor 7
Sequence
MMLISRLLGARWFPKTLPCDISLDPSKTHVIVDCTDKHLTEIPEGIPTNATNLTLTINHI
PSISPDSFHNLDHLIEVDFRCNCVPIRMGAKKNMCVRRLQIKPRSFSRLTYLKSLYLDGN
QLLEIPQDLPPSLQLLSLEANNIFVIMKENLTELVNIEMLFLGQNCYYRNPCNVSYSIEK
NAFLNLRNLKVLSLKDNNITAVPTLLPSNLTELYLYNNIITNIQEDDFNNLNQLEILDLS
GNCPRCYNVPFPCIPCENNSPLQIHVNAFDALTELQVLRLHSNSLQHVPVRWFKNMKNLR
ELDLSQNYLAKEIGDAKFLHLLPNLIQLDLSFNYELQVYHAFINLSHSFSSLKNLKILRI
KGYVFKELRYLNLSPLHDLHNLEVLDLGTNFIKIANLSIFKQFQKLKFIDLSMNKISPSE
DSSEIGFCSNTRTSVESNGPQVLETLHYFRYDKYARSCRFKNMETPFLTFNNDCNMYGQT
LDLSRNNIFFVKPSDFQHLSFLKCLNLSGNTIGQTLNGSEFQHLEQLKYLDFSNNRLDLL
HSTAFEELHNLEVLDLSMNSHYFQSEGITHMLNFTKNLKFLKKLMMNDNDISTSTSRTME
SKSLKILEFRGNHLDILWRDGDNRYLKFFKNLLNLEELDISRNSLSFLPPGVFDGMPPNL
KTLSLAKNGLQTFNWRKLSFLKNLEILDLSHNQLTTLPERLSNCSRSLKKLILMKNQIRH
LTKYFLKDAFQLRYLDLSSNKIQVIQKTSFPQNVLNNLEMLLLHRNRFLCNCDAVWFVWW
VNHTDVTIPYLATEVTCVGPGAHKGQSVVSLDLYTCELNLINLILFSVSISVALFLMVVM
TASHLYFWDMWYIYHFFKAKLRGYQRLRSAECCYDAFIVYDTKDPAVTEWVLDELVARLE
DPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTEKYAKTENFKIAFYLSHQR
LMDEKVDVIILIFLEKPFTKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALAMDN
HVVYSQMFKETV
Download sequence
Identical sequences G5BA96
HGL_H00000370034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]