SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000387331 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000387331
Domain Number 1 Region: 79-250
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.35e-48
Family DnaQ-like 3'-5' exonuclease 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000387331
Sequence length 612
Comment EXD2 (Homo_sapiens) exonuclease 3'-5' domain containing 2
Sequence
MSRQNLMALTVTTLLGVSVGGFVLWRGIQRRRKSPVTLEQLPTAQSPPEEDQLPSGVPRP
SWEERILQAKVVTVSREAEWDQIQPLLWSELEDFPVLGIDCEWVNLEGKASPLSLLQMAS
PSGLCVLVRLPKLIYGGKTLPKTLLDILADGTILKVGVGCSEDASKLLQDYGLMVRGCLD
LRYLATRQRNSLLCSGLSLKSLAETVLNFPLDKSLLLRCSNWDAENLTEDQVTYAARDAQ
ISVALFLHLLGHPFSKNSAEASSDPIGWRKVWEKCQDVVDIPFRSKGISRLGEEVNGEAT
ESQQKPRNKKYKSSGIVPGNHQGRDPRKNKRKPLGVGYSARKSPLYDNCFLHAPDGQPLC
TCDRRKAQWYLDKGIGELVSEDPFVVKLQFEPAGRPESPGGYCLLVKKNVCVVCGKTDSC
IRKNVIPHEYRKHFPIEMKDHNSHDVLLLCTSCHAISNYYDSHLKQQLAKEFQAPISSEE
GLRLLEDPERRQVRSGARALLNAVSLPASRKEELLQALREFYNRDSITDEMLQEAASLET
RISNESYTPHGLKVVQCHARGGLCSLMQLESRWRQHFLDSMQPKHLPQQWSVDYNHQKLL
RKYREDLPVKLS
Download sequence
Identical sequences G5BQN2
HGL_H00000387331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]