SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000393795 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000393795
Domain Number 1 Region: 81-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000444
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 479-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000476
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 3 Region: 710-765
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000139
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 528-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000326
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 618-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000141
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 571-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000039
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 7 Region: 773-797
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000398
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Weak hits

Sequence:  HGL_H00000393795
Domain Number - Region: 139-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00562
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000393795
Sequence length 881
Comment ZNF512B (Homo_sapiens) zinc finger protein 512B
Sequence
MSDPFCVGGGRRLQGSSKSGPGKGSSRKEVRLPVLQDPPKLGMPVVHSGQTVPGQAPLCF
EPGSPASDRTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRVKCPNSGCWLEFPSI
YGLKYHYQRCQGGAVSDRLAFPCPFCEAAFTSKTQLEKHRIWNHMDRPLATPKPGPVSRP
VTVSRPVGVSKPIGVSKPVTIGKPVGVSRPIGISKPVTVSRPVPVPRPMPVTKPVTVSRP
ITVTKAMPVTRPVPVTRPIPVTKPVPVSKLVTVTKPVPVTKPVPISRPIVVSKPVPVSRP
VAISRHTPPCKMVLLTKSENKALRAPGKSSGKKRAADSLDPCPIPPKQARPENGEYGPST
TGQSMAFQLSTDPSNSSLLLGSRPSMGKEVLRPAGPVFPPEEDPERTKHRRKQKTPKKFT
GEQPSISGTFGLKGLAKAEDKARIHRSKRQEGLGPEDVRKKVPATPITVSKEASTPVTHP
APGGPEEQWQRAIHERGEAVCPTCNVVTRKTIVGLKKHMEVCQKLQDALKCQHCRKQFKS
KAGLNYHTMAEHSAKPTDAEASEGSEQEERERLRKVLKQMGRLRCPQEGCGAAFSSLMGY
QYHQRRCGKPPCEVDTPSFPCAHCGKTYRSKAGHDYHVRSEHTAPPPEESMDKTPEAEDL
LGVARTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETARLNYTRPGLPT
LNPQLLEAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCSKGDHLVGKYHCLLCPK
EFSSESGVKYHILKTHAENWFRTSADPPPKHRSQDSLLPRREKKKTLGGGKKRGRKPKER
PPEEPVAKLPPSRDDWPLGGKDKGARGSTGRKVGAGKACEK
Download sequence
Identical sequences G5C8B2
HGL_H00000393795 XP_004841168.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]