SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_M00000024850 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_M00000024850
Domain Number 1 Region: 1623-1814
Classification Level Classification E-value
Superfamily Smc hinge domain 1.57e-20
Family Smc hinge domain 0.0025
Further Details:      
 
Domain Number 2 Region: 68-198
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000205
Family DNA gyrase/MutL, N-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000024850
Sequence length 1937
Comment Smchd1 (Mus_musculus) SMC hinge domain containing 1 Gene
Sequence
QTLGISPEEKFVITTTNRKEITCDNFDETVKDGVTLYLLQSVNQLLLSATKERIDFLPHY
DTLVKSGMYEYYASEGQNPLPFALAELIDNSLSATSRNVGIRRIQIKLLFDETQGKPAVA
VMDNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQ
AVFFVGQSARMISKPADSQDVHELVLSKEDFEKKEKNKEAIYSGYIRNRKPCDSVHITND
DERFLHNLILEEKEKDSFTAVVITGVQPEHIQYLKNYFHLWTRQLAHIYHYYIHGPKGNE
IHTSKEVEPFNNIDIEISMFEKGKAPKNVNLREIQDDMQTLYINTASDSFEFKAHVEGDG
VVEGIIRYHPFLYDRETYPDDPCFPSRLKDDDDDDDCFILEKAARGKRPIFECFWNGRLI
PYTSVEDFDWCTPPKKRGLAPIECYNRISGALFTNDKFQVSTNKLTFMDLELKLKDKNTL
FTRILNGQEIRMKIDREFALWLKDCHEKYDKQIKFTLFKGIITRPDLPSKKQGPWATYSA
IEWDGKIYKAGQLVKTIKTLPLFYGSIVRFFLYGDHDGEVYATGGEVQIAMEPQALYDEI
KTVPIAKLDRTVAEKTVKKYVEDEMARLPDRLSVTWPEGDELLPNEIRPAGTPIGALRIE
ILNKKGEAMQKLPGTSHGGSKKLLVELKVILHSSSGNKEIISHISQHGGKWPYWFKKMEN
IQKLGNYTLKLQVVLNESNADTYAGRPLPSKAIKFSVKEGKPEKFSFGLLDPPFRVGVPF
NIPLEFQDEFGHTSQLATDIQPVLETSGLSLHYEEITKGPNCVIRGVTANGPVNSCQGKN
FNLKVILPGLKEDSQILKIRLLPGPPRRLKVKPDSEILVIENGTAFPFQVEVLDESDNIT
AQPKLIVHCKFLGVPNLPVYVVDCSSSGTSILTGSAIQVQNIKKDQTLKARIEIPSCKDV
SPVEKTIKLLPSSHVARLQIFSVEGQKAIQIKHQDEVNWIAGDVMHNLIFQMYDEGEREI
NITSTLAEKIKVNWTPEVNKEHLLQGLLPDVQVPTSVKDMRYCQVSFQDDHVSLESAFTV
RPLPDEPKHLKCDLKGGKIVQMGQELQGEIVIIITDQYGNQVPAFSPSTLSALSIAGAGL
DNSSVKTALQENSQSVSVRGIRFIPGPPGNKDLCFSWHEFSDFIRVQLISGPPAKLLLID
WPELKEAIPVINGRELQSPLTVQLCDQWDNPAAVPHVKISLIKASNLKLTPSNQQHKTDE
KGQANLGVFVVSAPRGEHTMQVKAVYNKSTVEGPVIKLMILPDPEKPIRLNVKYDKDASF
LAGGIFTDFMVSVISEDDSIIKNINPARISMKMWKLSNNVNRPPANAETFSCNKIKDNDK
EEGCFYFRDKIIPNKVGTYCIQFGFMMDKANILNSEQVIVDVLPNRPVKLVPEIQPATPA
VSNVRSIASRTLVKDLRLNITDAYGNHTGIDLVGIVVATIKDFKEEDTDSPLFIGKVRTL
EFPFVNGSAEITSLVLAENSPGKDSTEYLIIFEPRLPRLSETLEPYILPFMFYNDVKKQQ
QMAALTKEKDELSKSIIMYRSLFEASKQLLDEMKCQVEEAKLKEAQLRNELKIHNIDIPT
TQQVEHIEALLKRKITEQEELRKKPRRSCTLPNYTKGGGDVLGKIAHLAQIEDDRAAMVI
SWHLASDMDCVVTMTTDAARRIYDETQGRQQVLPLDSIYKKTLPDWKRPLPHFRNGKLYF
KPFGNPVFARDLLTFTDNIEHCETVFGMLLGDTIILDNLDAANHYRKEVVKITHCPTLLT
RDGDRIRSNGKFGGLQNKAPPMDKLRGMVFGAPVPKQCLVLGEQIDLLQQYRAAVSKLGS
VSKDLSGQLQYLHTPDMKKKKQELDEQEKSLKLIEQRLGMTPTRKCNDSLHHSAKVEMTE
CPVPPKRMRREATRQNR
Download sequence
Identical sequences G5CAX7
HGL_M00000024850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]