SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_M00000049694 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_M00000049694
Domain Number - Region: 70-88
Classification Level Classification E-value
Superfamily SH3-domain 0.022
Family SH3-domain 0.0057
Further Details:      
 
Domain Number - Region: 35-96
Classification Level Classification E-value
Superfamily Subunit III of photosystem I reaction centre, PsaF 0.0327
Family Subunit III of photosystem I reaction centre, PsaF 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000049694
Sequence length 251
Comment 4930563D23Rik (Mus_musculus) RIKEN cDNA 4930563D23 gene Gene
Sequence
MPHSATPLLKNIIIRSQFDSIRRKQCLQYLKTLKSLRYDGFQTVYLGETDIPESLVTGED
FGNGYFLPTPTWCMVHAGGSQGWVPWNYQMFLRDELCTKQEDKLFFEFCDVVKKAYGKCA
IVVKGRRQENETKPKEDGEAEVQFYVPPVINLSSIVCCPEVAKFYGHELLSLPSPYNYLN
PLDSAWSSLKWFIINNRKGFCLQSTDNVYSYQYILFSDLISKGIERINLSKWKTIVKKVQ
RWENYYLGKFS
Download sequence
Identical sequences G5AM20
XP_004842395.1.39548 HGL_M00000049694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]