SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_M00000062995-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_M00000062995-1
Domain Number 1 Region: 22-119
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-17
Family SH3-domain 0.0000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000062995-1
Sequence length 684
Comment Dnahc10 (Mus_musculus) dynein, axonemal, heavy chain 10 Gene
Sequence
MARILLLFLPGLVAVCAGHGVFMDRLASKKLCADDECVYTISLARAQEDYNAPDCRFINV
KKGQQIYVYSKLVKENEAGEFWAGSVYGDHQTEMGIVGYFPSSLVKEQRVYQEATKEVLT
TAVALMEEFQGLDRDIEGSAKQWRKWVESECPEKEKLPQEWKKKNLIQKLIILRAVRPDR
MTYALRNFVEEKLGAKYVERTRLDLGKALEESSPATPVFFILSPGVDALKDLEMLGKRLG
FTIDSGKFYNVSLGQGQEKVAETALEKASRRGHWVILQNVHLVAKWLGTLEKLLEGFSQG
SHEDFRVFMSAESAPTPDEHIIPQGLLENSIKITNEPPTGMLANLHAALYNFNQDTLEIC
TKEQEFKSILFSLCYFHACVAGRLRFGSQGWSRSYPFNPGDLTICANVLYNYLEANPNVP
WEDLRYLFGEIMYGGHITDVWDRRLCQVYLEEFMNPSLIEDELMLAPGFAAPPYLDYSGY
HQYIEEMLPPESPALLVLEDIHFTKKHFYFFSYLRLTRFNDLLLRCRELDTWTQDLVLPA
VVWLSGFFNPQSFLTAIMQSMARKNEWPLDRMCLTVDVTKKVKEDYSHPPREGAYLHGLS
MEGARWDIQSGTIVQARLKELTSTMPVIFAKAIPMDRQETRQTYECPVYKNKMRGSTYIW
TFRLKSKEKTAKWVLAGVALLLEA
Download sequence
Identical sequences G5AMI3
HGL_M00000062995-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]