SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_M00000070718-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_M00000070718-1
Domain Number 1 Region: 29-76
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000209
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000070718-1
Sequence length 80
Comment Wfdc15a (Mus_musculus) WAP four-disulfide core domain 15A Gene
Sequence
MKPSSLSLLALTILLCLHVAQPGVRKNGIKQKPGFCPEFFLNCAFTGFPGCWSDRGCKGT
KKCCFYNCRRRCTEPWSSVT
Download sequence
Identical sequences G5BB24
HGL_M00000070718-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]