SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_M00000072084 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_M00000072084
Domain Number - Region: 122-204
Classification Level Classification E-value
Superfamily SIS domain 0.000208
Family mono-SIS domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000072084
Sequence length 295
Comment Gckr (Mus_musculus) glucokinase regulatory protein Gene
Sequence
MPITEKSNPLTRDLDKADAGKIVQLLGQCDAEIFQEEGQAMPAYQLTQAHPLDTHLHLSL
CPPSPFLLVWKLRALSPPTPIYTLLSWLLIPACSLQRLYSESVLTTMLQVAGKVQEVLKE
PDGGLVVLSGGGTSSRMAFLMSVSFNQLMTGLGQKPLYTYLIAGGDRSVVASREGKEDSA
LHGIEELKKVAAGKKRVIVIGISAGLSALGFPEERALCPEGKRNEPPSLRGANRGWQVEV
QAKRTRGSQDGWGPGDQDRMVQEEVQGVVLREASAPRLIISVAQISLCQLEAESL
Download sequence
Identical sequences G5BA52
HGL_M00000072084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]