SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_M00000090511 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_M00000090511
Domain Number 1 Region: 25-76
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000123
Family Elafin-like 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000090511
Sequence length 91
Comment Gm11428 (Mus_musculus) predicted gene 11428 Gene
Sequence
MKTSTVLVLVAFVVMGMDMAYAWLPVHTTQQKRGACPEVRRGQFGICVEACSGDQSCPRE
KKCCSNGCGHVCTAPVFKVSISLSRAVQGEN
Download sequence
Identical sequences G5CAW5
HGL_M00000090511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]