SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_M00000104462 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_M00000104462
Domain Number - Region: 105-192
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00044
Family FAD-linked reductases, N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000104462
Sequence length 271
Comment 4930438A08Rik (Mus_musculus) RIKEN cDNA 4930438A08 gene Gene
Sequence
MAKLTMAKTLKDAGHQEHMGLGSLVGDIGWRGRWGLAVDSPRAWARGQAGGPGQVEGVGD
QVADLIAEGPQKDTEGKPSALPGGMGVMAPGGMGVRWQTPATGLFQVTVLEAKGNVGSRI
EAHCIPRADWYIELGAMRIPGNHRLSSKFIWKSELNLTEFCPCINQTWVLVNRVRQHLGA
MHTNPDLLGYSVRAHEAGKMAEQLLEQSLMKVEEELKGSSCCHMLEKFNSFSTKQMIWDL
LNTDSGYYAAFKETLRGFIFFHEPWWTVGWE
Download sequence
Identical sequences G5BRH3
HGL_M00000104462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]