SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_N10019758 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10019758
Domain Number 1 Region: 11-74
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000249
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_N10019758
Sequence length 76
Sequence
MKMADRSRKTVPGQVYIEVEYDYEYEAKDRKVVIKQGERYILVKKTNDGWWQVKPDENAK
AFYVPAQYVKELTSET
Download sequence
Identical sequences G5BC62
HGL_N10019758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]