SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392425476|ref|YP_006466470.1| from Desulfosporosinus acidiphilus SJ4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392425476|ref|YP_006466470.1|
Domain Number 1 Region: 7-64
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000000000537
Family Di-heme elbow motif 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392425476|ref|YP_006466470.1|
Sequence length 81
Comment nitrate/TMAO reductase, membrane-bound tetraheme cytochrome c subunit [Desulfosporosinus acidiphilus SJ4]
Sequence
MWKKILLGSGITVVGLYVLFQVGYYATSGPNFCGSCHEVNKYVTSWQTAAHKNVNCLDCH
RDTGHAVDIYLRPDLKGYKQL
Download sequence
Identical sequences I4D5R4
WP_014827141.1.101568 gi|392425476|ref|YP_006466470.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]