SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374997852|ref|YP_004973351.1| from Desulfosporosinus orientis DSM 765

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374997852|ref|YP_004973351.1|
Domain Number 1 Region: 8-206
Classification Level Classification E-value
Superfamily PhoU-like 9e-33
Family PhoU-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374997852|ref|YP_004973351.1|
Sequence length 210
Comment phosphate uptake regulator [Desulfosporosinus orientis DSM 765]
Sequence
MFRKSGYDKVLLNLRVMTAELAEAVQNHLKAAIEALEKGETVLDWERQDDVIDQLRDNIV
DRSYDIMSLQQLRDQDLRWLLGFRRMAQELERSADYACDLAELSELRPEKDWPADIRQMA
KQLLFMIEYTTAILKGNKEIDRDLADEDDVLDEAYAEFKEALLKGSPRFNEGQLGIFLVI
ARTIERMGDHIVNVAETLLYIQTGKRRLAD
Download sequence
Identical sequences G7WGA4
WP_014187638.1.78142 gi|374997852|ref|YP_004973351.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]