SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|1173295|MIX19634_60_55 from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|1173295|MIX19634_60_55
Domain Number 1 Region: 268-381
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000497
Family BTB/POZ domain 0.0047
Further Details:      
 
Weak hits

Sequence:  jgi|Aspsy1|1173295|MIX19634_60_55
Domain Number - Region: 118-225
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0144
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|1173295|MIX19634_60_55
Sequence length 424
Sequence
MASRAAFEINMLAQGLKNMHISDIQARYHLEETTRHQSQSTQEDREAEVALPRGVLHDFK
LEAPNGFERSDEVRMVLTFCENLCIAIKERQRTVEWGIMEKVVQLRSPVHRRIILNVGLE
AAAEDDDLVLAAWILQNEWNTILDFLEKPMYAAAAAGNFDVVCCLMERLMRDDEMDRKIN
AALLGLRETHADAEDHLWMYRVSVIARALDVAIEKEFGDIVNLLMPLFQRVIQDDTGWPV
LQSFREVTIGRYLEFSRAQCMLLISEQRMPRILRDSIRCRLEDSEPFDIVIVAGGKEFMA
HRDILVFWSGFFATCYLSGVTRVPLDEGVSVNTMQRVYNFMYSGIYEDSESDDREQVLKD
LLWVATYMMIPKLADRVKDLLNIGLDLKDEEEDTEGLCRGLAFSCMNDEDDVDGLCRGLT
YSRM
Download sequence
Identical sequences A0A1L9TQD1
jgi|Aspsy1|1173295|MIX19634_60_55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]