SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|93141|gm1.9824_g from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|93141|gm1.9824_g
Domain Number 1 Region: 790-985
Classification Level Classification E-value
Superfamily Sec7 domain 6.41e-71
Family Sec7 domain 0.0000063
Further Details:      
 
Domain Number 2 Region: 211-300,555-625,714-732,1253-1670,1879-1967
Classification Level Classification E-value
Superfamily ARM repeat 2.88e-18
Family MIF4G domain-like 0.068
Further Details:      
 
Weak hits

Sequence:  jgi|Aspsy1|93141|gm1.9824_g
Domain Number - Region: 473-670,711-732
Classification Level Classification E-value
Superfamily ARM repeat 0.0038
Family Mo25 protein 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|93141|gm1.9824_g
Sequence length 1999
Sequence
MAEAENGSINELPQPSAPQADKQNGVDVVTEQPQTPDEVAESKPTLPDESERQEIQLSES
EKRESLQEGSDGDEHDLPREPSPASPKTTTEPLEPEDEQGQSYTRDDQTDSPREEQPSAS
EEQPNESPGIPSTQDEPPAQDMRLRSDSRSTTATFATHRSSTVSSTVFIVTALDTIGASR
EARKSKELEDAVKNALANVKQSDRNPIDPEVLFRPLLLASRTFSIPLQVTALDCIGKLIT
YSYFAFPSTQEAKVSESETPTEQPPLIERAIDAICDCFENEATAIEIQQQIIKSLLAAVL
NDKIVVHGAGLLKAVRQIYNMFIYSKSSQNQQIAQGSLTQMVSTVFDRLRVRLDLRELRI
REGEKAQAGSSDIVAIEASDVPSTAEDDQVSDVASVATDQPVSKEPTEKLTLESFESNKD
VTAVNDNVPTMVTRASINKKRAQSLSGASGEEKEAEEAANDEDDVDEIYVKDAFLVFRAL
CKLSHKILSHEQQQDLKSQNMRSKLLSLHLIHYLINNHVTIFTSPLLTIRNSSGSSEPMT
FLQAIRPHLCLSLSRNGSSSVPKVFEVCCEIFWLMLKHMRVMMKKELEVFMKEIYLAILE
KRNAPAFQKQYFMEVLERLADDPRALVEMYLNYDCDRTALENIFQNIIEQLSRYASVPTA
VSPAQQQQYHEQHVKASSVGNEWHQRGTLPPNLTSASIGNSQQPTVHNVPPEYILKHQAV
ECLVEILESLDNWASQRNVDQTVPRAFSQKSVDNPRDSLDSSAPTFLASPRVDGTDGSTG
RSTPVPDDDPSQVEKVKQRKIALTNAIQQFNFKPKRGIKLSLQEGFIRSDAPEEIASFIL
HNDRLDKAMIGEYLGEGDAENIAIMHAFVDMMDFAKRRFVDALRSFLQHFRLPGEAQKID
RFMLKFSERYVTQNPNAFANADTAYVLAYSVILLNTDQHSSKMKGRRMTKEDFIKNNRGI
NDNQDLPDEYLVSIFEEIASNEIVLDTEREQAANSGAPAAVPSGLASRAGQVFATVGRDI
QGEKYAQASEEMANKTEQLYRSLIRAQRKTAVKEALSRFIPATSVQHVGSMFNVTWMSFL
SGLSAPMQDTQNLKTIKLCMEGMKLAIRISCAFDLETPRVAFVTALAKFTNLGNVREMVA
KNVEALKILLDVALSEGNNLKSSWREILTCVSQLDRLQLLSDGVDEGSLPDVSRARVVPQ
SPSDGARRSIHAQRRPRPKSITGTTPFRAEIAMESRSTEMVKGVDRIFTNTANLSHEAII
DFVRALSEVSWQEIQSSGQTDSPRTYSLQKLVEISYYNMTRVRIEWSKIWEVLGQHFNQV
GCHSNTTVVFFALDSLRQLSMRFMEIEELPGFKFQKDFLKPFEHVMANSIAVTVKDMILR
CLIQMIQARGDNIRSGWKTMFGVFSFAAREPYEGIVNMAFEHVTQIYNTRFGVVITQGAF
PDLIVCLTEFSKNMRFQKKSLQAIELLKSTVTKMLRTPECPLSNRGTSSEGFHEDATNLT
QQLTRQSKEEQFWYPILIAFQDILMTGDDLEARSRALTYLFDTLIRYGGNFPQEFWDVLW
RQLLYPIFVVLQSKSEMSKVPNHEELSVWLSTTMIQALRHMITLFTHYFDALEYMLGRVL
ELLTLCICQENDTIARIGSNCLQQLILQNVEKFQKDHWSKTVGAFIELFSKTTAYELFTA
ATTATTMTPKTPLAQAVNGQTADIQEEAAQELDEPSPTQEAPVEPSKSNGTSDVTPEHED
GDMPATSGTELEDYRPQTDTQQQPAAVTVARRRYFNRIITNCVLQLLMIETVHELFSNDK
VYAQIPSHELLRLMGLLKKSYQFAKKFNEDKDLRMQLWRQGFMKSPPNLLKQESGSAATY
VHILFRMYHDEREERKSSRAETEAALIPLCADIISGFVRLDEDSQHRNIVAWRPVVVDVI
EGYTNFPVEGFDKHIETFYPLAVELLGRDLNPEIRLAIQSLLQRIGEARLGVPARPPAPV
SPRQSVSEKSSRKHSVGRR
Download sequence
Identical sequences A0A1L9T6T1
jgi|Aspsy1|93141|gm1.9824_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]