SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL003176-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HMEL003176-PA
Domain Number - Region: 62-132
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000131
Family Insect pheromone/odorant-binding proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMEL003176-PA
Sequence length 186
Comment pep:novel scaffold:Hmel1:HE668767:19415:22399:1 gene:HMEL003176 transcript:HMEL003176-RA description:""
Sequence
MSVRVLFIFIIVTACQANIQVSPPVTCGYLPRAIHECIGSPHIVKPEISAQCSKSISECE
RMTCVFQKSGWMSGNAVDKDKVKSYFDQFSTDNPQWALAVNHVKAACLNMDLPSQGVYLN
CPAYDILTCVFSGFIKNAQPDQWSSSESCSYPRQFASACPYCPSDCFAAQVPIGSCNACL
ALPRSP
Download sequence
Identical sequences HMEL003176-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]