SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL003460-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL003460-PA
Domain Number 1 Region: 234-268
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000445
Family SOCS box-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMEL003460-PA
Sequence length 269
Comment pep:novel scaffold:Hmel1:HE669169:15942:17456:-1 gene:HMEL003460 transcript:HMEL003460-RA description:""
Sequence
MLSRFHHYHGSNIILFEENTVAYRKTSFAHGLTFSEKPLLPGEIFLVEIEKTERGWSGHM
RLGLTLLDPQTAALGDKGLPQYALPDLANTGMSWIFPISKSQNNVISTFELVNQGSSGRR
DNEPRVSVLGDGHSVRTPRGYISKMVLRPQNLTQKGTPQGILPMDAGSRIGVMFVPCPKT
SKDAPDLAEMHFIINGEEQGPCTKAIPYTSGPLHAVVDVYGTTKQVKIIQLYGVKTLQNV
CRDAILQYVKSGSVRSLPLPQCLKDFLLS
Download sequence
Identical sequences HMEL003460-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]