SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL005571-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL005571-PA
Domain Number 1 Region: 43-217
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.19e-40
Family G proteins 0.0000237
Further Details:      
 
Domain Number 2 Region: 220-258
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000288
Family SOCS box-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMEL005571-PA
Sequence length 290
Comment pep:novel scaffold:Hmel1:HE670121:23858:28410:1 gene:HMEL005571 transcript:HMEL005571-RA description:""
Sequence
MFTTTGMVAAPQQATGQVAQNGSTTLPRSHHQRTGRPPAAPKSYDYLLKVLLVGDSDVGK
QEILQDLEDGSADSPFCSGSAYKTTTILLDGKRVKLQLWDTSGQGRFCTIIRSYSRGAQG
ILLVYDITNKWSFDSIDRWLEEVEKHAPGVPKVLVGNRLHLAFKRQVQERDAELYAAKNH
MAFFEVSPLCDFNIRESFCELSRMALHRNGMERLWRSNKVLSLQELCCRAIVARTSVYAL
ERLPLPTALKSHLKSYAISAAPARVRARAKHAHAHHARLNCAGRNSCCIA
Download sequence
Identical sequences HMEL005571-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]