SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL006421-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL006421-PA
Domain Number 1 Region: 20-132
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.22e-16
Family Insect pheromone/odorant-binding proteins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMEL006421-PA
Sequence length 134
Comment pep:novel scaffold:Hmel1:HE670420:2423:4323:1 gene:HMEL006421 transcript:HMEL006421-RA description:""
Sequence
MQFFMGQAENENPIAAMIHKSLTAVAHSCMERINGTEEDLEYLRKDPPFPEKSACIIVCL
LKKIGVVKDDNFSKTGFVTAVTPLVFHNRKKLEHMKNVSEKCDKEITTPKDTCQLGNSIT
ACIFKYAPELHYKT
Download sequence
Identical sequences HMEL006421-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]