SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMEL006640-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL006640-PA
Domain Number 1 Region: 52-87
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.000000000103
Family Ribosomal protein L36 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMEL006640-PA
Sequence length 110
Comment pep:novel scaffold:Hmel1:HE670471:43816:44977:1 gene:HMEL006640 transcript:HMEL006640-RA description:""
Sequence
MQRIISVAKTVIGMQIPRRNFDIITANFSIFQKSTEGILPTFVPNINPVCGFKVKGRVRR
RCKSCYFVCRQERVYVICPEHPRHKQMAMKAKPLNTYILTHASQSKVRPW
Download sequence
Identical sequences HMEL006640-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]