SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL006666-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL006666-PA
Domain Number 1 Region: 45-113
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000116
Family Insect pheromone/odorant-binding proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMEL006666-PA
Sequence length 122
Comment pep:novel scaffold:Hmel1:HE670475:120370:122688:-1 gene:HMEL006666 transcript:HMEL006666-RA description:""
Sequence
MLRIPLVAIFILKPISACCDIPEMGDVGPLSECSNPRLPGPCNEVQCVFEKSGFLIDKQT
LNKEAYRAHLRQWVEGHKGWEDAVEKAIKDCVDRDLRQYLDNPCKAYDVFTCTGIAMLKV
RK
Download sequence
Identical sequences HMEL006666-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]