SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL010226-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL010226-PA
Domain Number 1 Region: 12-122
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 4.71e-21
Family Insect pheromone/odorant-binding proteins 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMEL010226-PA
Sequence length 132
Comment pep:novel scaffold:Hmel1:HE671951:67404:68337:1 gene:HMEL010226 transcript:HMEL010226-RA description:""
Sequence
AITDEQKAMIHSHFEMLGKECIKDNLISADDIKNLRAKKIPSGENAPCFLACMFKKLGIM
DDAGLLQKETVLDLARKVFNDEDEIKLIGDYLHSCSHINTESVGDGDKGCDRSMMAYKCM
IENASQVLFTFN
Download sequence
Identical sequences HMEL010226-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]