SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL011634-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL011634-PA
Domain Number 1 Region: 224-550
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.69e-66
Family Ankyrin repeat 0.0000191
Further Details:      
 
Domain Number 2 Region: 9-60
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000326
Family Ankyrin repeat 0.008
Further Details:      
 
Domain Number 3 Region: 566-614
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000327
Family SOCS box-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMEL011634-PA
Sequence length 626
Comment pep:novel scaffold:Hmel1:HE672030:95808:102310:1 gene:HMEL011634 transcript:HMEL011634-RA description:""
Sequence
MDKLLEDRLYECIVLENHESILSLIQQGANPNKITSHGKTCLGEAAYLGNISIIHQLIDA
CKSNYPQNRNFTQSYSKKRHVKTHKRKLRSSSQHDDTVIKCKNPHDRALKCNPVSESTSV
LQDNQKCEKNQGYFVFIHSEGSSSDESKMCSLKSPVSPSSQVSSPQGELEWDEETANVAP
TTSEDETWSSMYKWYAAILECTGAAIASASVVTNGIDQQDAFMRTALHYAVEQGHTQIVK
LIIDTGCKVDIAAGDGLTSLHIAVMKNHAEIVRQLISAGSHVNYKTHEKMTPLHFAASRG
FLELVKILVNNGAYLEARDTSERTALYLAAGRGHVDVVSYLISVGANVNGEEIHGYTPLC
EAVWQRYTKVVEILLLSGARITHSHKLLHNAIIQRQEEIVRMLANMGGGINLHNDNGDTP
LLLAARLSQPTIAQILLQKGGNINSCNNITGASALHIAVESIDCPKEFEELLVCFLKYKI
DMNSTALTGDTALNRALLLQKDHAAVLLLRHGADVNACELHSCGLDNLSIASRRRSTHLA
NLLLKAGHHRPLPDSNPTSKCSTFLWIQDVCKQPQTLLDICRIRIRSICNNKPLFCYINA
LPLPKSLKRFLMLEDEGYTDVCISNE
Download sequence
Identical sequences HMEL011634-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]