SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL013351-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL013351-PA
Domain Number 1 Region: 26-140
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 6.8e-27
Family Insect pheromone/odorant-binding proteins 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMEL013351-PA
Sequence length 141
Comment pep:novel scaffold:Hmel1:HE671341:706468:711991:-1 gene:HMEL013351 transcript:HMEL013351-RA description:""
Sequence
MQSAALLAAVFLALITFGFGQKEKPEFSEEIKEIIQHVHNECVAKTEVTEEDIANCENGI
FKEDIKLKCYMFCLLEEGSLVDENDNVDYDMMISLIPEQYTDRVSKMITACKHLDTPDKN
KCQRAFDVHKCSYDSDPKVNF
Download sequence
Identical sequences HMEL013351-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]