SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL013981-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HMEL013981-PA
Domain Number - Region: 9-50
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0366
Family Insect pheromone/odorant-binding proteins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMEL013981-PA
Sequence length 63
Comment pep:novel scaffold:Hmel1:HE671409:36834:38690:1 gene:HMEL013981 transcript:HMEL013981-RA description:""
Sequence
MWNKVQSTLASQQSRVLLRDQLRACFQELQSESEDNGCSYSNKLERCLMLRFSNRKINQT
QAP
Download sequence
Identical sequences HMEL013981-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]