SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL015100-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL015100-PA
Domain Number 1 Region: 107-201
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-16
Family SH2 domain 0.00079
Further Details:      
 
Domain Number 2 Region: 215-274
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000955
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMEL015100-PA
Sequence length 275
Comment pep:novel scaffold:Hmel1:HE671985:2850:11250:1 gene:HMEL015100 transcript:HMEL015100-RA description:""
Sequence
MCLVERRETKLSPLNMTIATRLPTQNACLEVGVPLNSWSAGVACCPNCRHELRVSLACPK
NHHVPVTPLTPTFTVQPTYLPQIPLYNTPSSQFITSPLNDELKRLAETLRALRLSGWYYG
NLDWQGARNLLKDASVGAFVIRDSGDRNFIFSLSVQTERGPTSLTSQLDCDRPLARYMPR
FRCVVELVQHYTRVGQRGPAGTVWVDREGCPHSPVLLKSPLKKSPPTLLHSARLAIHKSI
DSNPLTPKLWTAPKHRLLPLPSTLIDYLGEYPYSI
Download sequence
Identical sequences HMEL015100-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]