SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL015207-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HMEL015207-PA
Domain Number - Region: 173-218
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0706
Family Insect pheromone/odorant-binding proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMEL015207-PA
Sequence length 240
Comment pep:novel scaffold:Hmel1:HE672080:10138:13224:1 gene:HMEL015207 transcript:HMEL015207-RA description:""
Sequence
MIYESCFGPDVVKQVRQEMKEAYAKCSSPPSVGEGLIQRVPSLILANLPQGFESDPATQT
ITKPTDGAVPENVPQILSHKQMLDNMFKQRPFQAPSVPNPYPMPNQFRPYPQPYYQFPLN
PMFYPPGVQYNPYTYQQQQYQQGFYQPPYFQQNNNRMSRDINIRDRFEMLSHMSNPGRTR
NITCVVQELGYLDHNMEPNYEQIAQRINNLPHKKLEACIMKDIRERFATDDDLDTDTDFR
Download sequence
Identical sequences HMEL015207-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]