SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL015925-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL015925-PA
Domain Number 1 Region: 9-115
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000000314
Family Insect pheromone/odorant-binding proteins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMEL015925-PA
Sequence length 121
Comment pep:novel scaffold:Hmel1:HE671542:46836:47201:1 gene:HMEL015925 transcript:HMEL015925-RA description:""
Sequence
AYIKVGKEFTEDAIKGSVHCTDELKLPVETLQTFLTSKYEDSLPMRKYIYCLGIMLDVGD
ENGNLKHSLSKYAGNNKRKAEILETIDECNKLEASDKYEKALKVSTCYLNKSSLLFEIKK
D
Download sequence
Identical sequences HMEL015925-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]