SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL015927-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL015927-PA
Domain Number 1 Region: 9-116
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000000011
Family Insect pheromone/odorant-binding proteins 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMEL015927-PA
Sequence length 121
Comment pep:novel scaffold:Hmel1:HE671542:49014:49379:1 gene:HMEL015927 transcript:HMEL015927-RA description:""
Sequence
AYIKVGKEFTEDAIKGSVHCTDELGLPVDTLQTFLTSKYEDSPLMRKYIYCLGIMLDVGE
EDGSLKHSLSKYAGNDKRKVEVLKTIDECNKLEASDKYEKAIKVSTCYLNKSPLLFEIKK
D
Download sequence
Identical sequences HMEL015927-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]