SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL017176-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL017176-PA
Domain Number 1 Region: 89-304
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-60
Family SPRY domain 0.000000015
Further Details:      
 
Weak hits

Sequence:  HMEL017176-PA
Domain Number - Region: 293-331
Classification Level Classification E-value
Superfamily SOCS box-like 0.00523
Family SOCS box-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMEL017176-PA
Sequence length 334
Comment pep:novel scaffold:Hmel1:HE672061:6616:10956:1 gene:HMEL017176 transcript:HMEL017176-RA description:""
Sequence
MTQFSISKGYFGRRYKSGVRSVRGGGAGGGGAEEARRSGLKALPKRARTRCRGMNMGQKL
SGGVKSVSRECPAPFKAVVARELAPEPPRPARLDALLDAPPAHPDTQLKHAWNPDDRSLN
IFVKEEDALTFHRHPVAQSTDCIRGRVGYSRGLHCWEVVWPARQRGTHAVVGVATSHAPL
HSVGYQSLVGATDQSWGWDLGRNKVFHNAKGTGGGGTTYPALLRPDEQFLVPDRLLVVLD
MDEGTLAFCADGRYLGVAARGLRGKTLYPIVSAVWGHAEITMKYIGGLDPEPLPLMELCR
RVIRQRVGRARLRAAASRLALPPALTAYLLYRAP
Download sequence
Identical sequences HMEL017176-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]